Follow us

Rabbit anti‑Human A4GALT IgG Polyclonal RW-C410351-20

https://www.giw-sg.com/web/image/product.template/155272/image_1920?unique=5362219
(0 review)

Antibody: A4GALT Rabbit anti-Human Polyclonal Antibody, Application: WB, Reactivity: Human, Mouse, Rat, Format: Unconjugated, Unmodified, Descriptio: A4GALT antibody RW-C410351 is an unconjugated rabbit polyclonal antibody to A4GALT from human. It is reactive with human, mouse and rat. Validated for WB., Targe: Human A4GALT, Synonym: A4GALT | A4GALT1 | A14GALT | Alpha4Gal-T1 | CD77 synthase | Globotriaosylceramide synthase | P(k) antigen synthase | p1/Pk synthase | P blood group (P one antigen) | P(k) | p1 | Gb3 synthase | Gb3S | PK, Hos: Rabbit, Reactivit: Human, Mouse, Rat (tested or 100% immunogen sequence identity), Clonalit: IgG Polyclonal, Conjugation: Unconjugated, Purificatio: Affinity purified, Modification: Unmodified, Immunoge: Recombinant fusion protein containing a sequence corresponding to amino acids 244-353 of human A4GALT (NP_059132.1). WIWGHQGPQLLTRVFKKWCSIRSLAESRACRGVTTLPPEAFYPIPWQDWKKYFEDINPEELPRLLSATYAVHVWNKKSQGTRFEATSRALLAQLHARYCPTTHEAMKMYL, Specificit: Human A4GALT, Application: Western blot (1:500 - 1:2000), Usag: The predicted MW is 40kDa, while the observed MW by Western blot was 45kDa., Presentatio: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol, Storag: Store at -20°C. Avoid freeze-thaw cycles., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About A4GAL: Uniprot: Q9NPC4 NCBI: NM_017436 NP_059132.1

503.00 503.0 USD 503.00

503.00

Not Available For Sale

    This combination does not exist.

    Terms and Conditions
    30-day money-back guarantee
    Shipping: 2-3 Business Days


    Cat: RW-52-375-98