Rabbit anti‑Human ABCC8 / SUR1 IgG Polyclonal RW-C782057-100

Antibody: ABCC8 / SUR1 Rabbit anti-Human Polyclonal Antibody, Application: WB, Flo, Reactivity: Human, Mouse, Rat, Format: Unconjugated, Unmodified, Descriptio: SUR1 antibody RW-C782057 is an unconjugated rabbit polyclonal antibody to SUR1 (ABCC8) from human. It is reactive with human, mouse and rat. Validated for Flow and WB., Targe: Human ABCC8 / SUR1, Synonym: ABCC8 | ABC36 | HI | PHHI | Sulfonylurea receptor | SUR | Sulfonylurea receptor 1 | MRP8 | SUR1delta2 | HHF1 | HRINS | SUR1 | TNDM2, Hos: Rabbit, Reactivit: Human, Mouse, Rat (tested or 100% immunogen sequence identity), Clonalit: IgG Polyclonal, Conjugation: Unconjugated, Purificatio: Antigen Affinity purification, Modification: Unmodified, Immunoge: Amino acids TIQREGTLKDFQRSECQLFEHWKTLMNRQDQELEKETVTERKA from the human protein were used as the immunogen for the SUR1 antibody., Application: Western blot (0.5 - 1 µg/ml)
Flow Cytometry (1 - 3 µg/10E6 cells), Usag: Optimal dilution of the SUR1 antibody should be determined by the researcher., Presentatio: Lyophilized from PBS, 2% Trehalose, 0.025% sodium azide, Reconstitutio: Reconstitute with 0.2ml distilled water, Storag: After reconstitution, store at 4°C for up to 1 month. Long-term: aliquot and store at -20°C. Avoid freeze-thaws cycles., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ABCC8 / SUR: Uniprot: Q09428 NCBI: NM_000352 NP_000343.2

Cat: RW-52-2021-124