Follow us

Rabbit anti‑Human A1CF / ACF IgG Polyclonal RW-C748148-20

https://www.giw-sg.com/web/image/product.template/155014/image_1920?unique=5362219
(0 review)

Antibody: A1CF / ACF Rabbit anti-Human Polyclonal Antibody, Application: WB, Reactivity: Human, Mouse, Format: Unconjugated, Unmodified, Descriptio: ACF antibody RW-C748148 is an unconjugated rabbit polyclonal antibody to ACF (A1CF) from human. It is reactive with human and mouse. Validated for WB., Targe: Human A1CF / ACF, Synonym: A1CF | ACF65 | ACF64 | APOBEC-1 stimulating protein | APOBEC1 complementation factor | APOBEC1CF | ACF | Apo-B RNA editing protein | APOBEC1-stimulating protein | RP11-564C4.2 | ASP, Hos: Rabbit, Reactivit: Human, Mouse (tested or 100% immunogen sequence identity), Clonalit: IgG Polyclonal, Conjugation: Unconjugated, Purificatio: Affinity purified, Modification: Unmodified, Immunoge: Recombinant fusion protein containing a sequence corresponding to amino acids 50-120 of human A1CF (NP_055391.2). APPERGCEIFIGKLPRDLFEDELIPLCEKIGKIYEMRMMMDFNGNNRGYAFVTFSNKVEAKNAIKQLNNYE, Application: Western blot (1:500 - 1:2000), Usag: The predicted MW is 55kDa/58kDa/62kDa/64kDa/65kDa, while the observed MW by Western blot was 65kDa., Presentatio: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol, Storag: Store at -20°C. Avoid freeze-thaw cycles., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About A1CF / AC: Uniprot: Q9NQ94 NCBI: NM_014576 NP_055391.2

503.00 503.0 USD 503.00

503.00

Not Available For Sale

    This combination does not exist.

    Terms and Conditions
    30-day money-back guarantee
    Shipping: 2-3 Business Days


    Cat: RW-52-117-77